PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015879936.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family NF-YB
Protein Properties Length: 203aa    MW: 21743 Da    PI: 7.0102
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015879936.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.86.5e-5818113297
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                     reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk+yl+k+re+ege
  XP_015879936.1  18 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIYLQKFREMEGE 112
                     89********************************************************************************************9 PP

           NF-YB  97 k 97 
                     k
  XP_015879936.1 113 K 113
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.8E-5515123IPR009072Histone-fold
SuperFamilySSF471133.88E-4120125IPR009072Histone-fold
PfamPF008086.0E-282387IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.9E-215169No hitNo description
PROSITE patternPS0068505470IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.9E-217088No hitNo description
PRINTSPR006151.9E-2189107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MADSDNDSGG HTNAASPREQ DRFLPIANVS RIMKKALPAN AKISKDAKET VQECVSEFIS  60
FITGEASDKC QREKRKTING DDLLWAMTTL GFEEYVEPLK IYLQKFREME GEKTALAGSS  120
GGRQGEREGG GGDVSGSVVN ITNSGVGFGG GTGGDGMYGG GVQSTTMMMM GQHHHHHHHH  180
HQAQSHGHHM YGSGSGTSTG RPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A8e-4916108294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B8e-4916108294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A9e-4916108193NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015879929.11e-150PREDICTED: nuclear transcription factor Y subunit B-3 isoform X1
RefseqXP_015879936.11e-150PREDICTED: nuclear transcription factor Y subunit B-3 isoform X2
SwissprotO233105e-78NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLD7UAG53e-90D7UAG5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g00440.t018e-90(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.13e-76nuclear factor Y, subunit B3